A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10029
Swiss-prot Accession number	P01226 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14387
References	1  PubMed abstract 11717129 2  PubMed abstract 670202 3  PubMed abstract 11717129 4  PubMed abstract 670202
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAVEKEECGFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATACHCGKCNSDSTDCTVRGLGPSYCSFGDMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P47799    Detail in HMRbase
Gene ID	100033829
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10075
Swiss-prot Accession number	Q8WN19 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Ailuropoda melanoleuca (Giant panda)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae;Ailuropoda.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14643
References	1  PubMed abstract 12654531 2  PubMed abstract 12654531
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKICTFKELAYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFNEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10112
Swiss-prot Accession number	P80663 (Sequence in FASTA format)
Description	Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	106 Amino acids
Molecular weight	11947
References	1  PubMed abstract 8925835 2  PubMed abstract 8925835
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAVEREECELCITVNATWCSGYCFTRDPVYKYPPVSEVQQTCTFKEVVYETVKIPGCRDHAESLYSYPVATECHCETCDTDSTDCTVRGLGPSYCSFNQ
Position of mature hormone in Pre-Hormone protein	106 Residues from position (1-106)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10118
Swiss-prot Accession number	Q98849 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	140 Amino acids
Molecular weight	15533
References	1  PubMed abstract 9073500 2   Sohn Y.C., Yoshiura Y., Suetake H., Kobayashi M., Aida K.; "Nucleotide sequence of gonadotropin II beta subunit gene ingoldfish."; Fish. Sci. 65:800-801(1999).
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-2
Mature Hormone Sequence	SYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFLVY
Position of mature hormone in Pre-Hormone protein	117 Residues from position (24-140)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10120
Swiss-prot Accession number	Q8HZR9 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Ailurus fulgens (Lesser panda) (Red panda)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ailuridae;Ailurus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15067
References	1   Liao M.J., Zhu M.Y., Zhang A.J.; "The lesser panda luteinizing hormone beta subunit."; Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMVRVLPAILPPMPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQPLACDRPPLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10121
Swiss-prot Accession number	Q2Q1P1 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15262
References	1   Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMMRVLQGVLPPLPQVVCTYRDVRFESIXLPGCPRGVDPMVSFPVALSCRCGPCHRSTSDCGGPNDHPLTCDHPQLSGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10122
Swiss-prot Accession number	Q6EV78 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15183
References	1  PubMed abstract 10612425
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPLCRPINATLAAEKEACPVCITVNTSICAGYCPTMMRVLQAALLPLPQVVCTYHEVRFDSIQLPGCLPGVDPVVSFPVALSCRCGPCHRSTSDCGGPKDHPLTCDHPQLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10123
Swiss-prot Accession number	Q95J85 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Monodelphis domestica (Short-tailed gray opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15032
References	1   Kacsoh B.; "Cloning of a cDNA encoding the luteinizing hormone beta chainprecursor in the marsupial, Monodelphis domestica."; Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	GAGSFRPLCRPTNATLAAESDACPVCVTFTTTICAGYCPSMVRVLPAALPPGPQLVCTYRELTFSWIRLPGCPPGVDPIFSFPVALSCACGSCRLSHSDCGGPRARPHLCTRPHLSLRLL
Position of mature hormone in Pre-Hormone protein	120 Residues from position (22-141)
Receptor	N/A
Gene ID	497247
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10124
Swiss-prot Accession number	Q9BDI9 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Panthera tigris altaica (Siberian tiger)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	142 Amino acids
Molecular weight	15117
References	1  PubMed abstract 12493701 2   Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLPFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (22-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10125
Swiss-prot Accession number	Q2Q1P2 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15333
References	1   Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPWCHPINATLAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	468950
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10126
Swiss-prot Accession number	Q6IY74 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	14752
References	1   Suzuki O.; "Rabbit luteinizing hormone gene."; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases. 2   Glenn S.D., Nahm H.S., Ward D.N.; "The amino acid sequence of the rabbit lutropin beta subunit."; J. Protein Chem. 3:259-273(1984).
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	QAPRGPLRPLCRPVNATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASIRLPGCPPGVDPEVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDLPHLPGLLFL
Position of mature hormone in Pre-Hormone protein	123 Residues from position (19-141)
Receptor	N/A
Gene ID	100009427
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10127
Swiss-prot Accession number	P80664 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	128 Amino acids
Molecular weight	12856
References	1  PubMed abstract 8925835
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	VPLGVPVALGVPPSRPPCRPVNVTVAAEKDECPQCLAVTTTACGGYCRTREPVYRSPLGGPAQQACGYGALRYERLALPGCAPGADPTVAVPVALSCRCARCPMATADCTVAGLGPAFCGAPAGFGPQ
Position of mature hormone in Pre-Hormone protein	128 Residues from position (1-128)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10166
Swiss-prot Accession number	Q28376 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15663
References	1   Kania S.A., Olchowy T.W., Frank L.A.; Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPDHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKANYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	N/A
Gene ID	100034188
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10200
Swiss-prot Accession number	Q3HRV4 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Aotus nancymaae (Ma's night monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Aotidae; Aotus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14609
References	1   Scammell J.G., Moyer F.S., Gibson S.V., Valentine D.L.; "Molecular cloning of glycoprotein alpha-subunit and folliclestimulating hormone and chorionic gonadotropin beta-subunits fromsquirrel monkey and owl monkey."; Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases. 2   Scammell J.G., Moyer F.S., Gibson S.V., Valentine D.L.; "Molecular cloning of glycoprotein alpha-subunit and folliclestimulating hormone and chorionic gonadotropin beta-subunits fromsquirrel monkey and owl monkey."; Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIENEECHFCISINTTWCAGYCYTRDLVYKDPATPNIQTTCTFKELVYETVRVPGCAHHADSFYTYPVATQCHCGKCDSDSTDCTMQGLGPDYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10201
Swiss-prot Accession number	Q6SV86 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Bubalus bubalis (Domestic water buffalo)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14593
References	1   Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 2   Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases. 3   Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 4   Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTYKELVYETVKVPGCAHHADSLYTYPVATECQCGKCDGDSTDCTVRGLGPSYCSFSESRE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10202
Swiss-prot Accession number	Q8HY84 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Cervus nippon (Sika deer)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14551
References	1   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 2   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHRADSLHTYPVATACHCGKCDSGSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10203
Swiss-prot Accession number	Q6SI68 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Mastomys coucha (Southern multimammate mouse) (Praomys coucha)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mastomys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	130 Amino acids
Molecular weight	14887
References	1  PubMed abstract 15364211 2  PubMed abstract 15364211
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	HSCELTNITISIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (20-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	10204
Swiss-prot Accession number	Q6U830 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Gerbillinae; Meriones.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14740
References	1  PubMed abstract 15081841 2  PubMed abstract 15081841
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITIAVEKEECRFCVSINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCAHHSDSFYTYPVATECHCSKCDSHSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	10205
Swiss-prot Accession number	Q95J82 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Monodelphis domestica (Short-tailed gray opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14737
References	1   Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary follicle-stimulating hormone beta (FSH-beta) precursor in the marsupial,Monodelphis domestica."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. 2   Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary follicle-stimulating hormone beta (FSH-beta) precursor in the marsupial,Monodelphis domestica."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CVLTNITISVEREECEFCISINTTWCSGYCHTRDLVYKEPIRPNIQKACTFREFVYETMSLPGCANQADSLYSYPVATACHCGSCDTDSTDCTVRGLGPSYCSFNERKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	554190
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	10206
Swiss-prot Accession number	Q9BDJ0 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Panthera tigris altaica (Siberian tiger)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14655
References	1  PubMed abstract 12493701 2   Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 12493701 4   Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	KSCELTNITITVEKEECRFCMSINATWCAGYCYTRDLVYKDPARPNNQKTCTFKELVYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVQGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	10207
Swiss-prot Accession number	Q2PUH2 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14660
References	1   Grigorova M., Laan M.; "FSHB gene has two major haplotypes."; Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases. 2   Grigorova M., Laan M.; "FSHB gene has two major haplotypes."; Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGHCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	736618
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	10208
Swiss-prot Accession number	Q6IY73 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14588
References	1   Suzuki O.; Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases. 2   Suzuki O.; Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SSCELTNITIAVEKEECRFCISINTTWCSGYCYTRDLVYKDPARPNIQKICTFKELVYETVRVPGCAHHADSLYTYPVATECHCGNCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	100008946
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	10209
Swiss-prot Accession number	Q9PS36 (Sequence in FASTA format)
Description	Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	107 Amino acids
Molecular weight	11794
References	1  PubMed abstract 1426958 2  PubMed abstract 1426958
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD
Position of mature hormone in Pre-Hormone protein	107 Residues from position (1-107)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	10210
Swiss-prot Accession number	Q3YC02 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14529
References	1   Scammell J.G., Moyer F.S., Gibson S.V., Valentine D.L.; "Molecular cloning of glycoprotein alpha-subunit and folliclestimulating hormone and luteinizing hormone beta-subunits from theBolivian squirrel monkey."; Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases. 2   Scammell J.G., Moyer F.S., Gibson S.V., Valentine D.L.; "Molecular cloning of glycoprotein alpha-subunit and folliclestimulating hormone and luteinizing hormone beta-subunits from theBolivian squirrel monkey."; Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIENEECHFCISINTTWCAGYCYTRDLVFKDPATPNIQTTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTTQGLGPDYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	10223
Swiss-prot Accession number	Q98848 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	130 Amino acids
Molecular weight	14423
References	1  PubMed abstract 9073500 2  PubMed abstract 9831661 3  PubMed abstract 9073500 4  PubMed abstract 9831661
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-1
Mature Hormone Sequence	GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSIFTYPVALSCECSKCNSDITDCGVLSQQTLGCNAH
Position of mature hormone in Pre-Hormone protein	112 Residues from position (19-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	10301
Swiss-prot Accession number	P54828 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15666
References	1   Kania S.A., Frank L.A.; Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCFPTEYTMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPRHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	P14763    Detail in HMRbase
Gene ID	403973
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 27

HMRbase accession number	10325
Swiss-prot Accession number	Q52R90 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15483
References	1  PubMed abstract 16122898
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCFPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFLYKTVEIPGCPHHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKTNDCTKPQKSD
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q9BGN4    Detail in HMRbase
Gene ID	554350
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 28

HMRbase accession number	10327
Swiss-prot Accession number	Q60687 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	130 Amino acids
Molecular weight	14919
References	1  PubMed abstract 8543187 2  PubMed abstract 16141072 3  PubMed abstract 15489334 4  PubMed abstract 8543187 5  PubMed abstract 16141072 6  PubMed abstract 15489334
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SCELTNITISVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	P35378    Detail in HMRbase
Gene ID	14308
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 29

HMRbase accession number	10329
Swiss-prot Accession number	Q6EV79 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14644
References	1  PubMed abstract 10612425 2  PubMed abstract 10612425
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P32212    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 30

HMRbase accession number	10357
Swiss-prot Accession number	Q9JK69 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14694
References	1   Suzuki O.; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 2   Suzuki O.; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NGCELTNITITVEREECRFCISVNTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATECQCGKCDSDSTDCTVRGLGPSYCSFSEIKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	Q8R428    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 31

HMRbase accession number	10401
Swiss-prot Accession number	O77835 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Rhinocerotidae;Ceratotherium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	14930
References	1  PubMed abstract 9723860 2  PubMed abstract 9305757
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPAPQPVCTYHELRFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 32

HMRbase accession number	10630
Swiss-prot Accession number	P30984 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH) (Fragment).
Source organism	Ctenopharyngodon idella (Grass carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Ctenopharyngodon.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	146 Amino acids
Molecular weight	16320
References	1   Chang Y.S., Huang F.-L., Lo T.-B.; "The cDNA cloning and primary structures of grass carp gonadotropinsubunits."; Submitted (JUL-1991) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-2
Mature Hormone Sequence	SSFLPPCEPVNETVAVEKEGCPKCLVFQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFPVY
Position of mature hormone in Pre-Hormone protein	118 Residues from position (29-146)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 33

HMRbase accession number	10631
Swiss-prot Accession number	P01235 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH).
Source organism	Cyprinus carpio (Common carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	144 Amino acids
Molecular weight	16040
References	1  PubMed abstract 3246480 2   Chang Y.S., Huang F.-L., Lo T.-B.; Submitted (MAY-1991) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 607993
Domain Name	Cys_knot
Hormone Name	Gonadotropin beta-II chain (GTH-II-beta)
Mature Hormone Sequence	SYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFL
Position of mature hormone in Pre-Hormone protein	115 Residues from position (28-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 34

HMRbase accession number	10632
Swiss-prot Accession number	P37038 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH).
Source organism	Hypophthalmichthys molitrix (Silver carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Hypophthalmichthys.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	141 Amino acids
Molecular weight	15856
References	1  PubMed abstract 2332148
Domain Name	Cys_knot
Hormone Name	Gonadotropin subunit beta-2
Mature Hormone Sequence	SFLPPCEPVNETVAVEKEGCPKCLVFQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDYCMSQREDFP
Position of mature hormone in Pre-Hormone protein	115 Residues from position (25-139)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 35

HMRbase accession number	10633
Swiss-prot Accession number	P33088 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	118 Amino acids
Molecular weight	12415
References	1   Karasev V.S., Pankov Y.A.; "Amino acid sequence of reduced and carboxymethylated alpha- and beta-subunits of the little picked whale luteinizing hormone."; Biokhimiia 50:1972-1986(1985).
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	PRGPLRPLCRPINATLAAZBZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRZLRFASIRLPGCPPGVBPMVSFPVALSCHCGPCRLSSSBCGPGRAZPLACBRSPRPGL
Position of mature hormone in Pre-Hormone protein	118 Residues from position (1-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 36

HMRbase accession number	10634
Swiss-prot Accession number	P18842 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain) (Fragment).
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	138 Amino acids
Molecular weight	14594
References	1  PubMed abstract 3697104
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (18-138)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 37

HMRbase accession number	10635
Swiss-prot Accession number	P45657 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Coturnix coturnix japonica (Japanese quail)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Coturnix.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	166 Amino acids
Molecular weight	17030
References	1  PubMed abstract 7515015
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	TPPLVVDPSIGSQLGLGSVLGLDLGSMGGSGRPPCRPINVTVAVEKEECPQCMAVTTTACGGYCRTREPVYRSPLGPPPQSSCTYGALRYERWDLWGCPIGSDPKVILPVALSCRCARCPIATSDCTVQGLGPAFCGAPGGFGGQ
Position of mature hormone in Pre-Hormone protein	145 Residues from position (22-166)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 38

HMRbase accession number	10636
Swiss-prot Accession number	P19794 (Sequence in FASTA format)
Description	Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain).
Source organism	Equus asinus (Donkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	169 Amino acids
Molecular weight	17943
References	1   Chopineau M., Combarnous Y., Allen W.R., Stewart F.; Submitted (JUL-1994) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2344391
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCRSMVRVMPAALPPIPQPVCTYRELRFGSIRLPGCPPGVDPMVSFPVALSCHCGPCRLKTTDCGGPRDHPLACAPQTSSSCKDPPSQPLTSTSTPTPGASRRSSHPLPINTS
Position of mature hormone in Pre-Hormone protein	149 Residues from position (21-169)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 39

HMRbase accession number	10637
Swiss-prot Accession number	O46641 (Sequence in FASTA format)
Description	Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain).
Source organism	Equus burchelli (Plains zebra) (Equus quagga)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	169 Amino acids
Molecular weight	17824
References	1  PubMed abstract 10341734
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPPIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCRLKTTDCGGPRDHPLACAPQASSSSKDPPSQPLTSTSTPTPGASNRSSHPLPIKTS
Position of mature hormone in Pre-Hormone protein	149 Residues from position (21-169)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 40

HMRbase accession number	10638
Swiss-prot Accession number	O77805 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	143 Amino acids
Molecular weight	15318
References	1   Pukazhenthi B.S., Varma G.M., Brown J.L.; "Molecular cloning and sequence analysis of the cDNA for the felineluteinizing hormone beta subunit."; Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (23-143)
Receptor	N/A
Gene ID	493833
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 41

HMRbase accession number	10639
Swiss-prot Accession number	P08751 (Sequence in FASTA format)
Description	Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	Microheterogeneity at Asn-33. O-glycosylation appears to be responsible for the beta subunit contribution to the difference in LH-receptor binding activity between LSH-B and CG-B.
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	169 Amino acids
Molecular weight	17865
References	1  PubMed abstract 1379674 2  PubMed abstract 3298239 3  PubMed abstract 3298238 4   Ward D.N., Moore W.T. Jr., Burleigh B.D.; "Structural studies on equine chorionic gonadotropin."; J. Protein Chem. 1:263-280(1982). 5  PubMed abstract 2331995 6  PubMed abstract 11133668
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPAIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFRDQPLACAPQASSSSKDPPSQPLTSTSTPTPGASRRSSHPLPIKTS
Position of mature hormone in Pre-Hormone protein	149 Residues from position (21-169)
Receptor	N/A
Gene ID	100054774
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 42

HMRbase accession number	10640
Swiss-prot Accession number	O46483 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain) (Fragment).
Source organism	Macropus rufus (Red kangaroo) (Megaleia rufa)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	138 Amino acids
Molecular weight	14698
References	1  PubMed abstract 9680384
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	ASPLRPLCRPTNATLAAESDACPVCVTFTTTICAGYCPSMVRVLPAALPPSPQLVCTYRELSFSSIRLPGCPPGVDPIFSFPVALSCSCGSCRLSHSDCGGPRAQPHLCTRPHLSLRLL
Position of mature hormone in Pre-Hormone protein	119 Residues from position (20-138)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 43

HMRbase accession number	10641
Swiss-prot Accession number	P45646 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Meleagris gallopavo (Common turkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	159 Amino acids
Molecular weight	16285
References	1  PubMed abstract 7772235
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	LGGGGRPPCRPINVTVAVEKDECPQCMAVTTTACGGYCRTREPVYRSPLGRPPQSSCTYGALRYERWALWGCPIGSDPRVLLPVALSCRCARCPIATSDCTVQGLGPAFCGAPGGFGIGE
Position of mature hormone in Pre-Hormone protein	120 Residues from position (40-159)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 44

HMRbase accession number	10642
Swiss-prot Accession number	P25330 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	118 Amino acids
Molecular weight	12412
References	1  PubMed abstract 3771098 2  PubMed abstract 6466737
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	PRGPLRPLCRPINATLAAQNZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRQLRFASIRLPGCPPGVNPMVSFPVALSCHCGPCRLSSSDCGPGRAQPLACNRSPRPGL
Position of mature hormone in Pre-Hormone protein	118 Residues from position (1-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 45

HMRbase accession number	10643
Swiss-prot Accession number	Q2Q1P0 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15355
References	1   Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQSVLPPLPQVVCTYRDVRFESIWLPGCPRGVDPVVSYAVALSCHCGLCRRSTSDCGGPKDHPLTCDHPQLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 46

HMRbase accession number	10644
Swiss-prot Accession number	P80071 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	112 Amino acids
Molecular weight	12676
References	1  PubMed abstract 1555571
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	RHVCHLANATISAEKDHCPVCITFTTSICTGYCQTMDPVYKTALSSFKQNICTYKEIRYDTIKLPDCLPGTDPFFTYPVALSCYCDLCKMDYSDCTVESSEPDVCMKRRISI
Position of mature hormone in Pre-Hormone protein	112 Residues from position (1-112)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 47

HMRbase accession number	10645
Swiss-prot Accession number	P01230 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15177
References	1  PubMed abstract 6192440 2  PubMed abstract 6096374 3   Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990).
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	25329
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 48

HMRbase accession number	10646
Swiss-prot Accession number	O46482 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Trichosurus vulpecula (Brush-tailed possum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Phalangeridae; Trichosurus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15061
References	1  PubMed abstract 9680384 2   Lawrence S.B., McNatty K.P., Fidler A.E.; Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	AGHLRPLCRPTNATLAAESDACPVCVTFTTTICAGYCPSMVRVLPAALPPGPQLVCTYRELSFSSIRLPGCPPGVDPIFSFPVALSCSCGSCRLSHSDCGGPRARPHLCTRPHLSLHL
Position of mature hormone in Pre-Hormone protein	119 Residues from position (23-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 49

HMRbase accession number	10774
Swiss-prot Accession number	Q08127 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Anguilla anguilla (European freshwater eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes
Protein Length	147 Amino acids
Molecular weight	16156
References	1  PubMed abstract 8044698 2  PubMed abstract 1933511
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	ICSPVDYTLYVEKPECDFCVAINTTICMGFCYSLDPNVVGPAVKRLVVQRGCTYQAVEYRTAELPGCPPHVDPRFSYPVALHCTCRACDPARDECTHRASADGDRCSKPLLLHMHAYPGQSNYIQTL
Position of mature hormone in Pre-Hormone protein	127 Residues from position (21-147)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 50

HMRbase accession number	10775
Swiss-prot Accession number	Q7ZZV4 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Anguilla japonica (Japanese eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes
Protein Length	147 Amino acids
Molecular weight	16088
References	1   Han Y.-S., Liao I.-C., Tzeng W.-N., Huang Y.-S., Yu J.Y.-L.; "Molecular cloning of the genomic DNA and cDNA encoding thyroidstimulating hormone beta subunit of the Japanese eel and its geneexpression."; Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases. 2   Nagae M., Qu X.C., Kazeto Y., Ijiri S., Ito F., Adachi S.,Yamauchi K.; "Molecular cloning of Japanese eel TSH beta."; Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	ICSPVDYTLYVEKPECDFCVAINTTICMGFCYSLDPNVVGPAVKRLAVQRGCTYQAVEYRTAELPGCPPHVDPRFSYPVALHCTCRACDPARDECTHRASADGDRCSKPLLLHMHAYPGQSNHIQTL
Position of mature hormone in Pre-Hormone protein	127 Residues from position (21-147)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 51

HMRbase accession number	10776
Swiss-prot Accession number	O57340 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	134 Amino acids
Molecular weight	15065
References	1  PubMed abstract 9245526
Domain Name	Cys_knot
Hormone Name	Cholecystokinin
Mature Hormone Sequence	HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	115 Residues from position (21-135)
Receptor	N/A
Gene ID	395937
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 52

HMRbase accession number	10777
Swiss-prot Accession number	O57340 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	134 Amino acids
Molecular weight	15065
References	1  PubMed abstract 9245526
Domain Name	Cys_knot
Hormone Name	Cholecystokinin 8
Mature Hormone Sequence	DYLGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (116-123)
Receptor	N/A
Gene ID	395937
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 53

HMRbase accession number	10778
Swiss-prot Accession number	P79357 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Lama glama (Llama)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Lama.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15571
References	1   Kania S.A., Frank L.A., Odom T.F.; Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDFNGKLFLPKFALSQDVCTYRDFMYKTVEIPGCPHHVTPYFSYPVAVSCKCGKCDTDYSDCIQEAVKMNYCTKPQKPH
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 54

HMRbase accession number	10779
Swiss-prot Accession number	Q95J88 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Monodelphis domestica (Short-tailed gray opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15398
References	1   Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary thyroidstimulating hormone (TSH, thyrotropin) beta of the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	LCVPTGYTMHIERRECAYCLTINTTICAGYCMTRDSNGKLFLPKSALSQDVCTYRDVIYRTVVMPGCPPHVIPYISYPVAVSCRCGKCNTDYIDCIHESVTTNYCTKPQKPY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	N/A
Gene ID	503501
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 55

HMRbase accession number	10780
Swiss-prot Accession number	P37240 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Pituitary gland. Higher levels seen in immature fishes than the mature fishes
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes
Protein Length	147 Amino acids
Molecular weight	16440
References	1  PubMed abstract 8327483
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNSYIHPN
Position of mature hormone in Pre-Hormone protein	127 Residues from position (21-147)
Receptor	N/A
Gene ID	100136289
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 56

HMRbase accession number	10781
Swiss-prot Accession number	O73824 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Salmo salar (Atlantic salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes
Protein Length	139 Amino acids
Molecular weight	15449
References	1   Martin S.A.M., Wallner W., Youngson A.F., Smith T.; "Differential expression of Atlantic salmon (Salmo salar) thyrotropinbeta subunit mRNA and its cDNA sequence."; J. Fish Biol. 54:757-766(1998).
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYHTLA
Position of mature hormone in Pre-Hormone protein	119 Residues from position (21-139)
Receptor	N/A
Gene ID	100136355
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 57

HMRbase accession number	10983
Swiss-prot Accession number	Q8HY83 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Capra hircus (Goat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14688
References	1   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 2   Ding J.T., Zhang J.Q., Sun H.C., Jiang X.P.; "Cloning and DNA sequence analysis of the cDNA for goat folliclestimulating hormone."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases. 3   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 4   Ding J.T., Zhang J.Q., Sun H.C., Jiang X.P.; "Cloning and DNA sequence analysis of the cDNA for goat folliclestimulating hormone."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCARHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 58

HMRbase accession number	10984
Swiss-prot Accession number	A1BN60 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14686
References	1  PubMed abstract 17227474 2  PubMed abstract 17227474
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	Residues from position 109
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 59

HMRbase accession number	10985
Swiss-prot Accession number	A1BN61 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14672
References	1  PubMed abstract 17227474 2  PubMed abstract 17227474
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	Residues from position 109
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 60

HMRbase accession number	10986
Swiss-prot Accession number	O46430 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Trichosurus vulpecula (Brush-tailed possum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Phalangeridae; Trichosurus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14704
References	1  PubMed abstract 9733063 2  PubMed abstract 9733063
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CMLTNITISVEREECEFCISINTTWCSGYCHTRDLVYKDPIRPNVQKTCTFKEFVYETVNLPGCAKQADSLYSYPVATACHCGSCDTDSTDCTVRGLGPSYCSFNERKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 61

HMRbase accession number	10996
Swiss-prot Accession number	O13050 (Sequence in FASTA format)
Description	Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH).
Source organism	Cyprinus carpio (Common carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	130 Amino acids
Molecular weight	14394
References	1   Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases. 2   Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Gonadotropin beta-I chain, GTH-I-beta
Mature Hormone Sequence	GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSVFTYPVALSCECSKCNSDITDCGALSQQTLSCNAH
Position of mature hormone in Pre-Hormone protein	112 Residues from position (19-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 62

HMRbase accession number	11227
Swiss-prot Accession number	O09108 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15028
References	1  PubMed abstract 8543188 2   Brown P., Brooks J., McNeilly J.R., McNeilly A.S.; Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	P30730    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 63

HMRbase accession number	11305
Swiss-prot Accession number	P01222 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain) (Thyrotropinalfa).
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15609
References	1  PubMed abstract 3839756 2  PubMed abstract 2457586 3  PubMed abstract 3234176 4  PubMed abstract 3243440 5  PubMed abstract 8196184 6  PubMed abstract 15489334 7  PubMed abstract 890569
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	P16473    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 64

HMRbase accession number	11306
Swiss-prot Accession number	P01223 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15624
References	1  PubMed abstract 6325416 2  PubMed abstract 5101174 3  PubMed abstract 5101173 4  PubMed abstract 8670056
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q27987    Detail in HMRbase
Gene ID	281552
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 65

HMRbase accession number	11307
Swiss-prot Accession number	P01224 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15761
References	1  PubMed abstract 2473932 2  PubMed abstract 8880412 3  PubMed abstract 1245181
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDFNGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPHHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q8SPP9    Detail in HMRbase
Gene ID	397658
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 66

HMRbase accession number	11308
Swiss-prot Accession number	P01225 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14700
References	1  PubMed abstract 2885163 2  PubMed abstract 2494176 3  PubMed abstract 3139991 4  PubMed abstract 16554811 5  PubMed abstract 15489334 6  PubMed abstract 3151250 7  PubMed abstract 1249074 8  PubMed abstract 4835136 9  PubMed abstract 6774759 10  PubMed abstract 11501762 11  PubMed abstract 11222739 12  PubMed abstract 15662415 13  PubMed abstract 10391209 14   Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N.,Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L.,Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q.,Lander E.S.; Nat. Genet. 23:373-373(1999). 15  PubMed abstract 2885163 16  PubMed abstract 2494176 17  PubMed abstract 3139991 18  PubMed abstract 16554811 19  PubMed abstract 15489334 20  PubMed abstract 3151250 21  PubMed abstract 1249074 22  PubMed abstract 4835136 23  PubMed abstract 6774759 24  PubMed abstract 11501762 25  PubMed abstract 11222739 26  PubMed abstract 15662415 27  PubMed abstract 8220432 28   Layman L.C., Lee E.-J., Peak D.B., Namnoum A.B., Vu K.V.,van Lingen B.L., Gray M.R., McDonough P.G., Reindollar R.H.,Jameson J.L.; "Delayed puberty and hypogonadism caused by mutations in the follicle-stimulating hormone beta-subunit gene."; N. Engl. J. Med. 337:607-611(1997). 29  PubMed abstract 9280841 30  PubMed abstract 10391209 31   Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N.,Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L.,Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q.,Lander E.S.; Nat. Genet. 23:373-373(1999).
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P23945    Detail in HMRbase
Gene ID	2488
PDB ID	1FL7   1XWD
Drugpedia	wiki
Comments

Search Result - 67

HMRbase accession number	11309
Swiss-prot Accession number	P01227 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14669
References	1  PubMed abstract 2505233 2  PubMed abstract 1930694 3  PubMed abstract 6798969 4  PubMed abstract 2505233 5  PubMed abstract 1930694 6  PubMed abstract 6798969
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	110 Residues from position (20-129)
Receptor	P35379    Detail in HMRbase
Gene ID	443387
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 68

HMRbase accession number	11310
Swiss-prot Accession number	P01228 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14605
References	1  PubMed abstract 2174241 2  PubMed abstract 10690358 3  PubMed abstract 3129323 4  PubMed abstract 658036 5  PubMed abstract 2174241 6  PubMed abstract 10690358 7  PubMed abstract 3129323 8  PubMed abstract 658036
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECNFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	P49059    Detail in HMRbase
Gene ID	396895
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 69

HMRbase accession number	11311
Swiss-prot Accession number	P01229 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Pituitary gland
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15345
References	1  PubMed abstract 6690982 2  PubMed abstract 1191677 3  PubMed abstract 4685398 4  PubMed abstract 4719207 5  PubMed abstract 1991473 6  PubMed abstract 1495492 7  PubMed abstract 1727547 8  PubMed abstract 9457942 9  PubMed abstract 9886510 10  PubMed abstract 11870227
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	P22888    Detail in HMRbase
Gene ID	3972
PDB ID	1M92
Drugpedia	wiki
Comments

Search Result - 70

HMRbase accession number	11312
Swiss-prot Accession number	P01231 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain) (Interstitial cell-stimulating hormone) [Contains: LH beta-1; LH beta-2; LH beta-3].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The LH alpha 3/LH beta 3 heterodimer was shown to have potent renotropic and weak gonadotropic activity
Protein Length	141 Amino acids
Molecular weight	15184
References	1  PubMed abstract 8349025 2  PubMed abstract 2336396 3  PubMed abstract 4556309 4  PubMed abstract 4575435 5  PubMed abstract 2456202 6  PubMed abstract 1201911 7  PubMed abstract 2209620
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCLSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	Q28585    Detail in HMRbase
Gene ID	443395
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 71

HMRbase accession number	11313
Swiss-prot Accession number	P01232 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	14889
References	1  PubMed abstract 2744222 2  PubMed abstract 1701088 3   Lv X., Gao R., Liu S., Li J.; "The sequence and expression of Meishan porcine LH-beta gene."; Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 4770795
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELSFASIRLPGCPPGVDPTVSFPVALSCHCGPCRLSSSDCGGPRAQPLACDRPLLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	P16582    Detail in HMRbase
Gene ID	397153
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 72

HMRbase accession number	11366
Swiss-prot Accession number	P04651 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15202
References	1  PubMed abstract 2987241 2  PubMed abstract 3838746 3  PubMed abstract 4770795
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	Q28005    Detail in HMRbase
Gene ID	280839   786429
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 73

HMRbase accession number	11367
Swiss-prot Accession number	P04652 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15505
References	1  PubMed abstract 6086256 2  PubMed abstract 3839124 3  PubMed abstract 3017658 4  PubMed abstract 3027091 5  PubMed abstract 15489334 6   Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990).
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIPGCPHHVAPYFSYPVALSCKCGKCNTDYSDCTHEAVKTNYCTKPQTFY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	P21463    Detail in HMRbase
Gene ID	25653
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 74

HMRbase accession number	11371
Swiss-prot Accession number	P04837 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14713
References	1  PubMed abstract 3092216 2  PubMed abstract 3096676 3  PubMed abstract 2840246 4  PubMed abstract 3092216 5  PubMed abstract 3096676 6  PubMed abstract 2840246
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCSKCDSDSTDCTVRGLGPSYCSFREIKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	P35376    Detail in HMRbase
Gene ID	281171
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 75

HMRbase accession number	11401
Swiss-prot Accession number	P12656 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15373
References	1  PubMed abstract 3349902 2  PubMed abstract 2824501 3  PubMed abstract 6207569 4  PubMed abstract 2484718
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYTMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	P47750    Detail in HMRbase
Gene ID	22094
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 76

HMRbase accession number	11415
Swiss-prot Accession number	P18427 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	130 Amino acids
Molecular weight	14814
References	1  PubMed abstract 3155259 2  PubMed abstract 2504572 3   Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990). 4  PubMed abstract 3155259 5  PubMed abstract 2504572 6   Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990).
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SCELTNITISVEKEECRFCISINTTWCEGYCYTRDLVYKDPARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	P20395    Detail in HMRbase
Gene ID	25447
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 77

HMRbase accession number	11505
Swiss-prot Accession number	Q812B2 (Sequence in FASTA format)
Description	Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Expressed in the anterior lobe of pituitary
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production
Protein Length	130 Amino acids
Molecular weight	14249
References	1   Feldhaus A., Holloway J.L., O'Hogan S.L., Tackett M., Taft D.,Thayer E.C., Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 16141072 3  PubMed abstract 16210345
Domain Name	Cys_knot
Hormone Name	Glycoprotein hormone beta-5
Mature Hormone Sequence	SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
Position of mature hormone in Pre-Hormone protein	106 Residues from position (25-130)
Receptor	P47750    Detail in HMRbase
Gene ID	217674
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 78

HMRbase accession number	11506
Swiss-prot Accession number	Q86YW7 (Sequence in FASTA format)
Description	Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta).
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Highly expressed in brain and at low levels in pituitary. Also found in retina, testis and skin but not in pancreas, parotid, kidney, stomach, liver, colon, small intestine, thyroid, brain or adrenal gland. In pituitary, colocalizes with ACTH, suggesting that it is located in corticotrophs
Post translational modification	N-glycosylated.
Function	Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production
Protein Length	130 Amino acids
Molecular weight	14232
References	1  PubMed abstract 12045258 2   Holloway J.L., O'Hogan S.L., Tackett M., Taft D., Thayer E.C.,Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 12508121 4  PubMed abstract 15489334 5  PubMed abstract 12089349 6  PubMed abstract 16210345
Domain Name	Cys_knot
Hormone Name	Glycoprotein hormone beta-5
Mature Hormone Sequence	ASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI
Position of mature hormone in Pre-Hormone protein	106 Residues from position (25-130)
Receptor	P16473    Detail in HMRbase
Gene ID	122876
PDB ID	N/A
Drugpedia	wiki
Comments