A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10445 |
Swiss-prot Accession number | P19209 (Sequence in FASTA format) |
Description | Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment). |
Source organism | Myxine glutinosa (Atlantic hagfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 34 Amino acids |
Molecular weight | 3963 |
References | 1 PubMed abstract 2896118 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-34 |
Mature Hormone Sequence | AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (1-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11145 |
Swiss-prot Accession number | P21779 (Sequence in FASTA format) |
Description | Somatostatin-37 [Contains: Somatostatin-34; Somatostatin-14]. |
Source organism | Petromyzon marinus (Sea lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 37 Amino acids |
Molecular weight | 4039 |
References | 1 PubMed abstract 2902094 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-34 |
Mature Hormone Sequence | AAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (4-37) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |