A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10140 |
Swiss-prot Accession number | Q60549 (Sequence in FASTA format) |
Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 107 Amino acids |
Molecular weight | 12298 |
References | 1 PubMed abstract 7703510 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | YADAIFTSSYRKVLGQLSARKLLQDIMSRQQGERNQEQGPRVRL |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (31-74) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10298 |
Swiss-prot Accession number | P07217 (Sequence in FASTA format) |
Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 44 Amino acids |
Molecular weight | 5123 |
References | 1 PubMed abstract 6440561 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (1-44) |
Receptor | Q8MHZ5 Detail in HMRbase Q9BDI0 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10706 |
Swiss-prot Accession number | P63293 (Sequence in FASTA format) |
Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
Source organism | Capra hircus (Goat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 44 Amino acids |
Molecular weight | 5109 |
References | 1 PubMed abstract 6440561 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (1-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10707 |
Swiss-prot Accession number | P42692 (Sequence in FASTA format) |
Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 45 Amino acids |
Molecular weight | 4979 |
References | 1 PubMed abstract 1475012 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS |
Position of mature hormone in Pre-Hormone protein | 45 Residues from position (1-45) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11397 |
Swiss-prot Accession number | P09916 (Sequence in FASTA format) |
Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 104 Amino acids |
Molecular weight | 12266 |
References | 1 PubMed abstract 3920534 2 PubMed abstract 1924334 3 PubMed abstract 7895659 4 PubMed abstract 6406907 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (31-73) |
Receptor | Q02644
Detail in HMRbase |
Gene ID | 29446 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11412 |
Swiss-prot Accession number | P16043 (Sequence in FASTA format) |
Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 103 Amino acids |
Molecular weight | 12064 |
References | 1 PubMed abstract 2514346 2 PubMed abstract 2481813 3 PubMed abstract 16141072 4 PubMed abstract 15489334 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
Position of mature hormone in Pre-Hormone protein | 42 Residues from position (31-72) |
Receptor | P32082
Detail in HMRbase |
Gene ID | 14601 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11493 |
Swiss-prot Accession number | P63292 (Sequence in FASTA format) |
Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 106 Amino acids |
Molecular weight | 12058 |
References | 1 Zhou P., Kazmer G.W., Yang X.; Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 6421287 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (31-74) |
Receptor | Q9BDH9 Detail in HMRbase Q9N1F8 Detail in HMRbase Q9TUJ0 Detail in HMRbase Q9TUJ1 Detail in HMRbase |
Gene ID | 281191 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |