A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11207 |
Swiss-prot Accession number | P14059 (Sequence in FASTA format) |
Description | Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II). |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 221 Amino acids |
Molecular weight | 25139 |
References | 1 PubMed abstract 2608054 2 PubMed abstract 2608054 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-3B1 |
Mature Hormone Sequence | SASPRLSTRNLYQRVVELSHCTHDLASKVFTDFNMKFGKSICRQKLMLYTCHTSSIPTPENREQVHQTNSEDLLKVTISVLQAWEEPVKHMVAAVAALPGTSDAMLSRAKELEERVLGLLEGLKIILNRIHPGAVENDYTFWSGWSDLQSSDEATRNIAFYTMGRCLRRDTHKVDNYLKVLKCRDIHNNNC |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (31-221) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11394 |
Swiss-prot Accession number | P09321 (Sequence in FASTA format) |
Description | Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II) (RPLII). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | Placental lactogen II is expressed from days 12 to term of pregnancy. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 221 Amino acids |
Molecular weight | 25007 |
References | 1 PubMed abstract 2874144 2 PubMed abstract 9492027 3 PubMed abstract 15489334 4 PubMed abstract 2874144 5 PubMed abstract 9492027 6 PubMed abstract 15489334 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-3B1 |
Mature Hormone Sequence | APNYRMSTGSLYQRVVELSHYTHDLASKVFIEFDMKFGRTVWTHNLMLSPCHTAAIPTPENSEQVHQAKSEDLLKVSITILQAWQEPLKHIVAAVATLPDGSDTLLSRTKELEERIQGLLEGLETILSRVQPGAVGSDYTFWSEWSDLQSSDKSTKNGVLSVLYRCMRRDTHKVDNFLKVLKCRDIYNNNC |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (31-221) |
Receptor | P05710
Detail in HMRbase |
Gene ID | 24283 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11395 |
Swiss-prot Accession number | P09586 (Sequence in FASTA format) |
Description | Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | Placental lactogen I is expressed in mid- pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25159 |
References | 1 PubMed abstract 3464966 2 PubMed abstract 1570305 3 PubMed abstract 3859868 4 PubMed abstract 3464966 5 PubMed abstract 1570305 6 PubMed abstract 3859868 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-3B1 |
Mature Hormone Sequence | LPNYRLPTESLYQRVIVVSHNAHDLASKAFMEFEMKFGRTAWTYGLMLSPCHTAAILTPENSEQVHQTTSEDLLKVSITILQAWEEPLKHMVAAVAALPHVPDTLLSRTKELEERIQGLLEGLKIIFNRVYPGAVASDYTFWSAWSDLQSSDESTKNSALRTLWRCVRRDTHKVDNYLKVLKCRDVHNNNC |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (32-222) |
Receptor | Q08501
Detail in HMRbase |
Gene ID | 18776 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |