A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10251 |
Swiss-prot Accession number | Q91189 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 178 Amino acids |
Molecular weight | 19998 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | QSEGTFSNYYSKYQEERMARDFLHWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (52-80) |
Receptor | N/A |
Gene ID | 100136748 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10253 |
Swiss-prot Accession number | P81027 (Sequence in FASTA format) |
Description | Glucagon-2 (Glucagon II). |
Source organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 33 Amino acids |
Molecular weight | 3731 |
References | 1 PubMed abstract 7656183 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | HAGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRD |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10254 |
Swiss-prot Accession number | Q9PUR0 (Sequence in FASTA format) |
Description | Glucagon-2 precursor [Contains: Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)]. |
Source organism | Petromyzon marinus (Sea lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 120 Amino acids |
Molecular weight | 13397 |
References | 1 PubMed abstract 10555286 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | HSQGSFTSDYSKHLDVKQAKDFVTWLLNT |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (44-72) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11073 |
Swiss-prot Accession number | P04092 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-2 (Glucagon II); Glucagon-like peptide 2(Glucagon-like peptide II)]. |
Source organism | Lophius americanus (American goosefish) (Anglerfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 122 Amino acids |
Molecular weight | 14171 |
References | 1 PubMed abstract 6338015 2 PubMed abstract 3526301 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | HSEGTFSNDYSKYLETRRAQDFVQWLKNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (52-80) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |