A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11171 |
| Swiss-prot Accession number | P23362 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12665 |
| References | 1 PubMed abstract 2174979 2 "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (46-103) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11184 |
| Swiss-prot Accession number | P01356 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Synthesized in both cerebral cortex and duodenal mucosa |
| Post translational modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
| Protein Length | 114 Amino acids |
| Molecular weight | 12526 |
| References | 1 PubMed abstract 6205394 2 Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3 PubMed abstract 5410106 4 PubMed abstract 8443599 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (45-102) |
| Receptor | N/A |
| Gene ID | 397468 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11190 |
| Swiss-prot Accession number | P80344 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)]. |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem |
| Post translational modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Protein Length | 130 Amino acids |
| Molecular weight | 14449 |
| References | 1 PubMed abstract 9075736 2 PubMed abstract 7925386 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | RIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (61-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11196 |
| Swiss-prot Accession number | P80345 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 40 (CCK40); Cholecystokinin 33 (CCK33);Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
| Source organism | Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Expressed in brain, duodenum and small intestine |
| Post translational modification | N/A |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Protein Length | 130 Amino acids |
| Molecular weight | 14603 |
| References | 1 PubMed abstract 10561540 2 PubMed abstract 7925386 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | RLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (61-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11373 |
| Swiss-prot Accession number | P06307 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12669 |
| References | 1 PubMed abstract 3856870 2 Kato K., Takahashi Y., Matsubara K.; "Molecular cloning of the human cholecystokinin gene."; Ann. N. Y. Acad. Sci. 448:613-615(1985). 3 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 4 Livingston R.J., Rieder M.J., Chung M.-W., Ritchie T.K., Olson A.N.,Nguyen C.P., Nguyen D.A., Poel C.L., Robertson P.D., Schackwitz W.S.,Sherwood J.K., Sherwood A.M., Leithauser B.J., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 15489334 6 PubMed abstract 11076522 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (46-103) |
| Receptor | P32239 Detail in HMRbase P32238 Detail in HMRbase |
| Gene ID | 885 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11446 |
| Swiss-prot Accession number | P41520 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12835 |
| References | 1 Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2217909 3 PubMed abstract 4011954 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (46-103) |
| Receptor | P79266
Detail in HMRbase |
| Gene ID | 617510 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |