A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11463 |
Swiss-prot Accession number | P48757 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 101 Amino acids |
Molecular weight | 11607 |
References | 1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266 |
Domain Name | Gastrin |
Hormone Name | Gastrin-71 |
Mature Hormone Sequence | SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 71 Residues from position (22-92) |
Receptor | P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |