A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11447 |
Swiss-prot Accession number | P41520 (Sequence in FASTA format) |
Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
Protein Length | 115 Amino acids |
Molecular weight | 12835 |
References | 1 Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2217909 3 PubMed abstract 4011954 |
Domain Name | Gastrin |
Hormone Name | Cholecystokinin-58 desnonopeptide |
Mature Hormone Sequence | AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISD |
Position of mature hormone in Pre-Hormone protein | 49 Residues from position (46-94) |
Receptor | P79266
Detail in HMRbase |
Gene ID | 617510 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |