A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11436 |
Swiss-prot Accession number | P33093 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone) (GH) (GH-N) (Pituitary growthhormone) (Growth hormone 1). |
Source organism | Macaca mulatta (Rhesus macaque) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 217 Amino acids |
Molecular weight | 24913 |
References | 1 PubMed abstract 8404617 2 PubMed abstract 3080959 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
Receptor | P79194
Detail in HMRbase |
Gene ID | 718156 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |