A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11419 |
Swiss-prot Accession number | P19402 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cavia porcellus (Guinea pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 256 Amino acids |
Molecular weight | 28264 |
References | 1 PubMed abstract 1662166 2 PubMed abstract 2830360 3 PubMed abstract 1662166 4 PubMed abstract 2830360 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKGKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 91 Residues from position (166-256) |
Receptor | Q9Z1S9
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |