![]() |
|
|
|
|
|
|
HMRbase accession number | 11411 |
Swiss-prot Accession number | P14676 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 229 Amino acids |
Molecular weight | 25863 |
References | 1 PubMed abstract 2925618 2 PubMed abstract 2765112 3 Ohkubo T., Tanaka M., Nakashima K.; "Cloning and characterization of chicken prolactin gene."; Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases. 4 Au W.L., Leung F.C.; "Genomic sequence of chicken prolactin gene."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. 5 Cui J.X., Liang Y., Du H.L., Zhang X.Q.; "Polymorphisms of chicken prolactin gene."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q04594
Detail in HMRbase |
Gene ID | 396453 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |