A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11407 |
| Swiss-prot Accession number | P13389 (Sequence in FASTA format) |
| Description | Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1]. |
| Source organism | Ovis aries (Sheep) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Neurophysin 1 specifically binds oxytocin |
| Protein Length | 125 Amino acids |
| Molecular weight | 12635 |
| References | 1 PubMed abstract 2798140 2 PubMed abstract 2095591 3 Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959). |
| Domain Name | Hormone_5 |
| Hormone Name | Neurophysin 1 |
| Mature Hormone Sequence | AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH |
| Position of mature hormone in Pre-Hormone protein | 94 Residues from position (32-125) |
| Receptor | Q28756
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |