A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11379 |
| Swiss-prot Accession number | P06880 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 216 Amino acids |
| Molecular weight | 24716 |
| References | 1 PubMed abstract 2991252 2 PubMed abstract 8647448 3 PubMed abstract 16141072 4 PubMed abstract 15489334 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (27-216) |
| Receptor | P16882
Detail in HMRbase |
| Gene ID | 14599 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |