A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11369 |
Swiss-prot Accession number | P04808 (Sequence in FASTA format) |
Description | Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Prostate. Not expressed in placenta, decidua or ovary |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 185 Amino acids |
Molecular weight | 21146 |
References | 1 PubMed abstract 6548702 2 PubMed abstract 6298628 3 PubMed abstract 15164053 4 PubMed abstract 15489334 5 PubMed abstract 8735594 6 PubMed abstract 10601981 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | VAAKWKDDVIKLCGRELVRAQIAICGMSTWS |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (23-53) |
Receptor | Q9HBX9 Detail in HMRbase Q8WXD0 Detail in HMRbase |
Gene ID | 6013 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |