A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11356 |
| Swiss-prot Accession number | P01355 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 39(CCK39); Cholecystokinin 33 (CCK33); Cholecystokinin 22 (CCK22);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | The shortest form (CCK8) is predominantly found in the brain, whereas the larger ones are found in the intestine |
| Post translational modification | Cholecystokinin, also known as CCK58, is proteolytically cleaved to produce a number of active cholecystokinins. Sulfation of Tyr-97 is essential for receptor activation. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12841 |
| References | 1 PubMed abstract 2981840 2 PubMed abstract 6199787 3 PubMed abstract 3861130 4 PubMed abstract 6209267 5 PubMed abstract 12479974 6 Varro A., Young J., Gregory H., Csech J., Dockray G.J.; "Isolation, structure and properties of the C-terminal fragment of therat cholecystokinin precursor."; Regul. Pept. 15:195-195(1986). 7 PubMed abstract 8208365 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-33 |
| Mature Hormone Sequence | KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (71-103) |
| Receptor | P30553 Detail in HMRbase P30551 Detail in HMRbase |
| Gene ID | 25298 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |