A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11352 |
| Swiss-prot Accession number | P01353 (Sequence in FASTA format) |
| Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
| Source organism | Canis familiaris (Dog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
| Protein Length | 104 Amino acids |
| Molecular weight | 11519 |
| References | 1 PubMed abstract 2262079 2 PubMed abstract 3763441 3 PubMed abstract 5799207 4 PubMed abstract 2756156 |
| Domain Name | Gastrin |
| Hormone Name | Big gastrin |
| Mature Hormone Sequence | QLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
| Receptor | P30552
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |