A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11350 |
Swiss-prot Accession number | P01352 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11573 |
References | 1 PubMed abstract 2608050 2 PubMed abstract 1773057 3 PubMed abstract 5665711 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P79266
Detail in HMRbase |
Gene ID | 280800 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |