A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11344 |
Swiss-prot Accession number | P01350 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Gastrin-71 (Component I); Gastrin-52(G52); Big gastrin (Gastrin-34) (G34) (Component II); Gastrin(Gastrin-17) (G17) (Component III); Gastrin-14 (G14); Gastrin-6 (G6)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | Two different processing pathways probably exist in antral G- cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins, gastrin-34 and gastrin-17. In the putative alternative pathway, progastrin may be processed only at the most C-terminal dibasic site resulting in the synthesis of gastrin-71. Sulfation of Tyr-87 blocks peptide degradation and enhances activity. |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 101 Amino acids |
Molecular weight | 11394 |
References | 1 PubMed abstract 3034736 2 PubMed abstract 6087340 3 PubMed abstract 6324077 4 PubMed abstract 6574456 5 PubMed abstract 6322186 6 PubMed abstract 6689486 7 PubMed abstract 15489334 8 PubMed abstract 8055952 9 PubMed abstract 5921183 10 PubMed abstract 2730647 11 PubMed abstract 5822140 12 PubMed abstract 7530658 13 PubMed abstract 11052986 |
Domain Name | Gastrin |
Hormone Name | Gastrin-71 |
Mature Hormone Sequence | SWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 71 Residues from position (22-92) |
Receptor | P32239
Detail in HMRbase |
Gene ID | 2520 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |