A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11340 |
Swiss-prot Accession number | P01323 (Sequence in FASTA format) |
Description | Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 110 Amino acids |
Molecular weight | 12339 |
References | 1 PubMed abstract 498284 2 PubMed abstract 2427930 3 PubMed abstract 6249167 4 PubMed abstract 4311938 5 PubMed abstract 4640931 6 PubMed abstract 4554104 |
Domain Name | Insulin |
Hormone Name | Insulin-2 B chain |
Mature Hormone Sequence | FVKQHLCGSHLVEALYLVCGERGFFYTPMS |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
Receptor | P15127
Detail in HMRbase |
Gene ID | 24506 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |