![]() |
|
|
|
|
|
|
HMRbase accession number | 11332 |
Swiss-prot Accession number | P01275 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas. |
Function | GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton. Inhibits beta cell apoptosis |
Protein Length | 180 Amino acids |
Molecular weight | 20909 |
References | 1 PubMed abstract 2901414 2 PubMed abstract 3725587 3 PubMed abstract 6877358 4 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 15815621 6 PubMed abstract 15489334 7 PubMed abstract 11946536 8 PubMed abstract 2753890 9 PubMed abstract 8482423 10 PubMed abstract 14557443 11 PubMed abstract 14632334 12 PubMed abstract 9287128 13 PubMed abstract 12651102 14 PubMed abstract 14719035 15 PubMed abstract 12554744 16 PubMed abstract 12626323 17 PubMed abstract 10322410 18 PubMed abstract 10605628 19 PubMed abstract 9667960 20 PubMed abstract 11943215 21 PubMed abstract 12627948 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1 |
Mature Hormone Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Position of mature hormone in Pre-Hormone protein | 37 Residues from position (92-128) |
Receptor | P47871
Detail in HMRbase |
Gene ID | 2641 |
PDB ID | 1BH0 1D0R 1NAU |
Drugpedia | wiki |
Comments |