A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11292 |
Swiss-prot Accession number | P01201 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Macaca nemestrina (Pig-tailed macaque) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Protein Length | 264 Amino acids |
Molecular weight | 29172 |
References | 1 PubMed abstract 3229286 2 PubMed abstract 13760276 3 PubMed abstract 3229286 4 PubMed abstract 13760276 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (135-173) |
Receptor | Q864J8
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |