A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11269 |
| Swiss-prot Accession number | P01191 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment). |
| Source organism | Ovis aries (Sheep) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 212 Amino acids |
| Molecular weight | 23464 |
| References | 1 PubMed abstract 8384993 2 Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3 PubMed abstract 4344689 4 PubMed abstract 4370084 5 PubMed abstract 13929167 6 PubMed abstract 4162144 7 PubMed abstract 4675453 8 PubMed abstract 4270658 9 PubMed abstract 843377 10 PubMed abstract 8384993 11 Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12 PubMed abstract 4344689 13 PubMed abstract 4370084 14 PubMed abstract 13929167 15 PubMed abstract 4162144 16 PubMed abstract 4675453 17 PubMed abstract 4270658 18 PubMed abstract 843377 |
| Domain Name | ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin beta (Beta-LPH) |
| Mature Hormone Sequence | ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKK |
| Position of mature hormone in Pre-Hormone protein | 91 Residues from position (122-212) |
| Receptor | Q9TU77 Detail in HMRbase O19037 Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |