A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11251 |
Swiss-prot Accession number | P01189 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Protein Length | 267 Amino acids |
Molecular weight | 29424 |
References | 1 PubMed abstract 6274691 2 PubMed abstract 6299668 3 PubMed abstract 6314261 4 PubMed abstract 15489334 5 PubMed abstract 3606677 6 PubMed abstract 6254047 7 PubMed abstract 6945581 8 PubMed abstract 6267033 9 PubMed abstract 6272808 10 PubMed abstract 4352834 11 PubMed abstract 14463577 12 PubMed abstract 15340161 13 PubMed abstract 4334191 14 PubMed abstract 4338630 15 PubMed abstract 4347148 16 PubMed abstract 1264228 17 Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18 PubMed abstract 195688 19 PubMed abstract 2424570 20 PubMed abstract 2839146 21 PubMed abstract 7828531 22 PubMed abstract 9620771 23 PubMed abstract 16046320 24 PubMed abstract 16807684 25 PubMed abstract 9768693 26 PubMed abstract 10193875 27 PubMed abstract 11244459 28 PubMed abstract 12165561 29 PubMed abstract 6274691 30 PubMed abstract 6299668 31 PubMed abstract 6314261 32 PubMed abstract 15489334 33 PubMed abstract 3606677 34 PubMed abstract 6254047 35 PubMed abstract 6945581 36 PubMed abstract 6267033 37 PubMed abstract 6272808 38 PubMed abstract 4352834 39 PubMed abstract 14463577 40 PubMed abstract 15340161 41 PubMed abstract 4334191 42 PubMed abstract 4338630 43 PubMed abstract 4347148 44 PubMed abstract 1264228 45 Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46 PubMed abstract 195688 47 PubMed abstract 2424570 48 PubMed abstract 2839146 49 PubMed abstract 7828531 50 PubMed abstract 9620771 51 PubMed abstract 16046320 52 PubMed abstract 16807684 53 PubMed abstract 9768693 54 PubMed abstract 10193875 55 PubMed abstract 11244459 56 PubMed abstract 12165561 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (138-176) |
Receptor | Q01726
Detail in HMRbase |
Gene ID | 5443 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |