A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11207 |
Swiss-prot Accession number | P14059 (Sequence in FASTA format) |
Description | Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II). |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 221 Amino acids |
Molecular weight | 25139 |
References | 1 PubMed abstract 2608054 2 PubMed abstract 2608054 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-3B1 |
Mature Hormone Sequence | SASPRLSTRNLYQRVVELSHCTHDLASKVFTDFNMKFGKSICRQKLMLYTCHTSSIPTPENREQVHQTNSEDLLKVTISVLQAWEEPVKHMVAAVAALPGTSDAMLSRAKELEERVLGLLEGLKIILNRIHPGAVENDYTFWSGWSDLQSSDEATRNIAFYTMGRCLRRDTHKVDNYLKVLKCRDIHNNNC |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (31-221) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |