A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11191 |
Swiss-prot Accession number | P80344 (Sequence in FASTA format) |
Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)]. |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem |
Post translational modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
Protein Length | 130 Amino acids |
Molecular weight | 14449 |
References | 1 PubMed abstract 9075736 2 PubMed abstract 7925386 |
Domain Name | Gastrin |
Hormone Name | Cholecystokinin-33 |
Mature Hormone Sequence | GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (86-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |