A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11121 |
Swiss-prot Accession number | P15438 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments). |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 103 Amino acids |
Molecular weight | 11721 |
References | 1 PubMed abstract 3260236 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1 |
Mature Hormone Sequence | HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (39-70) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |