A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11099 |
Swiss-prot Accession number | P09566 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide] (Fragment). |
Source organism | Lepisosteus spatula (Alligator gar) (Atractosteus spatula) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Semionotiformes; Lepisosteidae;Lepisosteus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. |
Protein Length | 78 Amino acids |
Molecular weight | 9000 |
References | 1 PubMed abstract 3282974 2 PubMed abstract 3311873 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-36 |
Mature Hormone Sequence | HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGIT |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |