A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11098 |
Swiss-prot Accession number | P04093 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon; Glucagon-like peptide](Fragment). |
Source organism | Ictalurus punctatus (Channel catfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 71 Amino acids |
Molecular weight | 8183 |
References | 1 PubMed abstract 3030323 2 PubMed abstract 3838546 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide |
Mature Hormone Sequence | HADGTYTSDVSSYLQEQAAKDFITWLKSGQPKPE |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (38-71) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |