![]() |
|
|
|
|
|
|
HMRbase accession number | 11097 |
Swiss-prot Accession number | O12956 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Heloderma suspectum (Gila monster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Anguimorpha; Helodermatidae;Heloderma. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in salivary glands |
Post translational modification | N/A |
Function | GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis |
Protein Length | 204 Amino acids |
Molecular weight | 23553 |
References | 1 PubMed abstract 9020121 2 PubMed abstract 12554744 3 PubMed abstract 12626323 4 PubMed abstract 10322410 5 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HADGTFTSDYNQLLDDIATQEFLKWLINQKVTQ |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (164-196) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |