A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11093 |
Swiss-prot Accession number | P68259 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1 and GLP-2. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide (By similarity). |
Function | GLP-1 is a potent stimulator of glucose-dependent insulin release |
Protein Length | 206 Amino acids |
Molecular weight | 23876 |
References | 1 PubMed abstract 2338135 2 PubMed abstract 7776976 3 PubMed abstract 1194290 4 PubMed abstract 2828209 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1 |
Mature Hormone Sequence | HSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRG |
Position of mature hormone in Pre-Hormone protein | 37 Residues from position (112-148) |
Receptor | N/A |
Gene ID | 396196 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |