A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11079 |
Swiss-prot Accession number | P01272 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20944 |
References | 1 PubMed abstract 6577439 2 Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 5102927 4 PubMed abstract 12554744 5 PubMed abstract 12626323 6 PubMed abstract 10322410 7 PubMed abstract 10605628 8 PubMed abstract 6631957 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | 280802 |
PDB ID | 1KX6 |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |