A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11074 |
Swiss-prot Accession number | P04092 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-2 (Glucagon II); Glucagon-like peptide 2(Glucagon-like peptide II)]. |
Source organism | Lophius americanus (American goosefish) (Anglerfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 122 Amino acids |
Molecular weight | 14171 |
References | 1 PubMed abstract 6338015 2 PubMed abstract 3526301 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (89-119) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |