A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11070 |
Swiss-prot Accession number | P01278 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-1 (Glucagon I); Glucagon-like peptide 1(Glucagon-like peptide I)]. |
Source organism | Lophius americanus (American goosefish) (Anglerfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 124 Amino acids |
Molecular weight | 14165 |
References | 1 PubMed abstract 7043459 2 PubMed abstract 6165720 3 PubMed abstract 3058456 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 1 |
Mature Hormone Sequence | HADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (91-124) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |