A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11068 |
Swiss-prot Accession number | Q9DFJ9 (Sequence in FASTA format) |
Description | Thymosin beta. |
Source organism | Gillichthys mirabilis (Long-jawed mudsucker) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Gobioidei;Gobiidae; Gillichthys. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 4914 |
References | 1 PubMed abstract 11172064 |
Domain Name | Thymosin |
Hormone Name | Thymosin beta |
Mature Hormone Sequence | SDKPDVKEVESFDKTTLKKTTTNEKNTLPTKEVIEQEKSGGSD |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |