A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11067 |
Swiss-prot Accession number | Q9DET5 (Sequence in FASTA format) |
Description | Thymosin beta. |
Source organism | Coturnix coturnix japonica (Japanese quail) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Coturnix. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 45 Amino acids |
Molecular weight | 5245 |
References | 1 Dathe V.E., Prols F., Brand-Saberi B.; Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta |
Mature Hormone Sequence | CDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (2-45) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |