HMRbase accession number | 11059 |
Swiss-prot Accession number | P62328 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta 4) (Fx) [Contains: Hematopoietic systemregulatory peptide (Seraspenide)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 5053 |
References | 1 PubMed abstract 3500230 2 PubMed abstract 16010977 3 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
4 PubMed abstract 1999398 5 PubMed abstract 6548414 6 PubMed abstract 10848969
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-4 |
Mature Hormone Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | 7114 |
PDB ID | 1UY5 |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |