HMRbase accession number | 11057 |
Swiss-prot Accession number | P62327 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 5053 |
References | 1 Hoerger S., Gallert B., Kellerman J., Voelter W.; "Isolation and structural identification of beta-thymosins from equinetissue: development of a specific ELISA against thymosin beta-10(TBeta-10)."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.749-750, Escom Science Publishers, Leiden (1993).
2 Takafuji V.A., Crisman M.V., Seat K.L., Sharova L.V., Ward D.L.,Howard R.D.; "Expression analysis of equine interleukin-1b treated equine synoviumusing suppression subtractive hybridization analysis (SSH-PCR)."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-4 |
Mature Hormone Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |