![]() |
|
|
|
|
|
|
HMRbase accession number | 11051 |
Swiss-prot Accession number | P26351 (Sequence in FASTA format) |
Description | Thymosin beta-11. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 42 Amino acids |
Molecular weight | 4820 |
References | 1 Sakai M., Kono T.; "The cDNA sequence of rainbow trout thymosin beta."; Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 1575682 3 Echner H., Yialouris P.P., Haritos A.A., Gruebler G., Voelter W.; "Structure and syntheses of thymosin beta-11 and beta-12."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.751-752, Escom Science Publishers, Leiden (1993). |
Domain Name | Thymosin |
Hormone Name | Thymosin beta-11 |
Mature Hormone Sequence | SDKPNLEEVASFDKTKLKKTETQEKNPLPTKETIEQEKQAS |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (2-42) |
Receptor | N/A |
Gene ID | 100170202 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |