A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11035 |
Swiss-prot Accession number | P07660 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 138 Amino acids |
Molecular weight | 15308 |
References | 1 PubMed abstract 3666142 2 PubMed abstract 4054101 3 PubMed abstract 3838160 4 PubMed abstract 3782060 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (82-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |