A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11033 |
| Swiss-prot Accession number | P01260 (Sequence in FASTA format) |
| Description | Calcitonin. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Protein Length | 32 Amino acids |
| Molecular weight | 3596 |
| References | 1 PubMed abstract 5259773 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Calcitonin |
| Mature Hormone Sequence | CSNLSTCVLSAYWKDLNNYHRFSGMGFGPETP |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |