A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11031 |
Swiss-prot Accession number | P01265 (Sequence in FASTA format) |
Description | Calcitonin-3. |
Source organism | Oncorhynchus kisutch (Coho salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3419 |
References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-3 |
Mature Hormone Sequence | CSNLSTCMLGKLSQDLHKLQTFPRTNTGAGVP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |