A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11028 |
Swiss-prot Accession number | P01263 (Sequence in FASTA format) |
Description | Calcitonin-1 precursor. |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 136 Amino acids |
Molecular weight | 15179 |
References | 1 PubMed abstract 3691820 2 PubMed abstract 5261048 3 PubMed abstract 5361911 4 PubMed abstract 1991104 5 PubMed abstract 2043752 6 PubMed abstract 1931969 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-1 |
Mature Hormone Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (83-114) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | 2GLG 2GLH |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |