A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11021 |
Swiss-prot Accession number | O62819 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Monodelphis domestica (Short-tailed gray opossum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 228 Amino acids |
Molecular weight | 26071 |
References | 1 Kacsoh B., Soos G.; "Cloning and characterization of pituitary prolactin cDNA from themarsupial Monodelphis domestica."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLSDLFDRAVMLSHYIHSPSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIRHEDLLNLVLRVLRSWSEPLYHLVTEVRSMQEAPDTILLKAMEIEEQNKRLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
Receptor | N/A |
Gene ID | 100017831 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |