![]() |
|
|
|
|
|
|
HMRbase accession number | 11002 |
Swiss-prot Accession number | P55752 (Sequence in FASTA format) |
Description | Prolactin-2 (Prolactin II) (PRL-II). |
Source organism | Alligator mississippiensis (American alligator) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 199 Amino acids |
Molecular weight | 22743 |
References | 1 PubMed abstract 1399264 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |