A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11002 |
| Swiss-prot Accession number | P55752 (Sequence in FASTA format) |
| Description | Prolactin-2 (Prolactin II) (PRL-II). |
| Source organism | Alligator mississippiensis (American alligator) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 199 Amino acids |
| Molecular weight | 22743 |
| References | 1 PubMed abstract 1399264 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-2 |
| Mature Hormone Sequence | LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |