A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10996 |
Swiss-prot Accession number | O13050 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 130 Amino acids |
Molecular weight | 14394 |
References | 1 Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases.
2 Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin beta-I chain, GTH-I-beta |
Mature Hormone Sequence | GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSVFTYPVALSCECSKCNSDITDCGALSQQTLSCNAH |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (19-130) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |