A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10993 |
| Swiss-prot Accession number | Q9BDI8 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Panthera tigris altaica (Siberian tiger) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13499 |
| References | 1 PubMed abstract 12493701 2 Liao M.J., Zhu M.Y., Zhang A.J.; "Panthera tigris altaica pituitary glycoprotein hormone alphasubunit."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 12493701 4 Liao M.J., Zhu M.Y., Zhang A.J.; "Panthera tigris altaica pituitary glycoprotein hormone alphasubunit."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPVYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |