A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10993 |
Swiss-prot Accession number | Q9BDI8 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
Source organism | Panthera tigris altaica (Siberian tiger) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13499 |
References | 1 PubMed abstract 12493701 2 Liao M.J., Zhu M.Y., Zhang A.J.; "Panthera tigris altaica pituitary glycoprotein hormone alphasubunit."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 12493701 4 Liao M.J., Zhu M.Y., Zhang A.J.; "Panthera tigris altaica pituitary glycoprotein hormone alphasubunit."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPVYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |