A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10981 |
Swiss-prot Accession number | Q9YGK2 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Thunnus obesus (Bigeye tuna) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 24970 |
References | 1 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
2 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQRPLLTLFKNVINKDGQQQK |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (191-222) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |