A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10971 |
| Swiss-prot Accession number | P01194 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 235 Amino acids |
| Molecular weight | 26540 |
| References | 1 PubMed abstract 2998878 2 PubMed abstract 6547437 3 PubMed abstract 6255341 4 PubMed abstract 7259753 5 PubMed abstract 2998878 6 PubMed abstract 6547437 7 PubMed abstract 6255341 8 PubMed abstract 7259753 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELEGEQPDGLEQVLEPDTEKADGPYRVEHFRWGNPPKD |
| Position of mature hormone in Pre-Hormone protein | 38 Residues from position (165-202) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |