A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10942 |
Swiss-prot Accession number | P10000 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 226 Amino acids |
Molecular weight | 24982 |
References | 1 PubMed abstract 3197404 2 PubMed abstract 6095185 3 PubMed abstract 6087806 4 PubMed abstract 7447938 5 PubMed abstract 475783 6 PubMed abstract 3197404 7 PubMed abstract 6095185 8 PubMed abstract 6087806 9 PubMed abstract 7447938 10 PubMed abstract 475783 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (98-138) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |