A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10938 |
| Swiss-prot Accession number | P11280 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment). |
| Source organism | Mustela vison (American mink) (Neovison vison) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | N/A |
| Protein Length | 142 Amino acids |
| Molecular weight | 15822 |
| References | 1 PubMed abstract 3397057 2 PubMed abstract 3382437 3 PubMed abstract 3397057 4 PubMed abstract 3382437 |
| Domain Name | ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKD |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (52-109) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |